CDS

Accession Number TCMCG066C36054
gbkey CDS
Protein Id XP_034574560.1
Location join(35676003..35676141,35676656..35676752,35676829..35676907,35677263..35677567,35678137..35678146)
Gene LOC117838586
GeneID 117838586
Organism Setaria viridis

Protein

Length 209aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA633601
db_source XM_034718669.1
Definition mediator of RNA polymerase II transcription subunit 31 [Setaria viridis]

EGGNOG-MAPPER Annotation

COG_category K
Description Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
KEGG_ko ko:K15153        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000428        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003712        [VIEW IN EMBL-EBI]
GO:0003713        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0005667        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009891        [VIEW IN EMBL-EBI]
GO:0009893        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0010557        [VIEW IN EMBL-EBI]
GO:0010604        [VIEW IN EMBL-EBI]
GO:0016591        [VIEW IN EMBL-EBI]
GO:0016592        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0030880        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031325        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031328        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044798        [VIEW IN EMBL-EBI]
GO:0045935        [VIEW IN EMBL-EBI]
GO:0048518        [VIEW IN EMBL-EBI]
GO:0048522        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051173        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051254        [VIEW IN EMBL-EBI]
GO:0055029        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0061695        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070847        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0090575        [VIEW IN EMBL-EBI]
GO:0140110        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1902680        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:1903508        [VIEW IN EMBL-EBI]
GO:1990234        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCCTATACTGGGTCCGCCCCTGTGTCCGACGTCGAGTCCGCCCCTGGTGAGGGCGAGAAGGGCGAGAAGCCGCCTCCGCGATTCGAACTCGAGTTGGAGTTCGTGCAGTGCCTCGCCAACCCTACCTACATTCACTATCTAGCACAGAATAGATATTTTGAGGATGAGGCATTTATCGGATACCTCAAGTACCTAAAATATTGGCAGCGTCCGGAGTATATCAAATACATAATGTATCCACACTGCCTTTTCTTTCTTGAGCTCCTCCAAAATGCCAATTTCCGCAATGCAATGGCACATCCAGCAAGCAAGGAGCTTGCTCACAGGCAGCAATATTTCTTCTGGAAAAACTACAGGAATAATAGAATGAAGCACATCTTACCACGCCCTCCTCCTGAACCAGCTCCTGCGGCACCTTCACAAGGACCTGCAGTGATGCCCCTACCACCATCAGTACCGACACCTGTGGCCCCACCTGTTCCCGCGCCGGCATCATCTATGCCAGCCGTGGCAACAGGTGGTGCATCTGCAATGTCTCCTATGCAGTTTGTAGGAACTCCCGGCACCAATATGCCGAAGACCGACATGAGAAATGCTATGGGCAACAGAAAGAGGAAGATGGGCTAG
Protein:  
MSYTGSAPVSDVESAPGEGEKGEKPPPRFELELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKELAHRQQYFFWKNYRNNRMKHILPRPPPEPAPAAPSQGPAVMPLPPSVPTPVAPPVPAPASSMPAVATGGASAMSPMQFVGTPGTNMPKTDMRNAMGNRKRKMG